PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G2548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 961aa    MW: 107895 Da    PI: 5.0133
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G2548genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.6e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
      Gh_D11G2548  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding29.91.3e-0960103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc + + k+l
      Gh_D11G2548  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLEQYEKLL 103
                      68*****************99.********8..******99999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.2E-131070No hitNo description
CDDcd001675.20E-121053No hitNo description
SuperFamilySSF466898.27E-2033106IPR009057Homeodomain-like
CDDcd116598.30E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1357104IPR009057Homeodomain-like
PROSITE profilePS5129414.22358107IPR017930Myb domain
SMARTSM007177.1E-1258105IPR001005SANT/Myb domain
PfamPF118315.3E-61406654IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 961 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLEQYE KLLDAACARD ENYEPGDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIPFEKRPP PGFYDVADED RPVEQPKFPT  240
TIEELEGKRR VDIEAQLRKQ DIAKNKIAQR QDAASAILQA NKLNDPEAVR KRSKLMLPEP  300
QISNHELEEI AKMGYASDLL AGNEELAEGS SATRALLANY SQTPRQGVTP LRTPQRTPAG  360
KGDAIMMEAE NLARLRESQT PLLGGENPEL HPSDFSGVTP KMQVQTPNPM LTPAATPGGT  420
GLTPRIGMTP SRDGYSFGLT PKGTPIRDEL HINEDMDLHD SAKLEQRRQA DIRRNLRSGL  480
GSLPQPKNEY QIVVQPPPEE SEEPEEKIEE DMSDRIARER AEEEARQQAL LKKRSKVLQR  540
ELPRPPSASL ELIRDSLMRT DGDKSTFVPP TLIEQADEMI RKELLSLLEH DNAKYPLDEK  600
ANKGKKKGAK RSANGSIPSI EDFEEDEMKE ADSWVKEEAE FLRVAMGHEN ESLDDFVEAH  660
NTCLNDLMYF PTRHAYGLSS VAGNTEKLAA LQTEFDHVKK KMDNDKLKAE GMEKKFNVLT  720
QGYERRAATL WRQIESTFKQ IDTAGTELEC FQALQKQEQL AASHRINGLW EEAQKQKELE  780
QTLQSHYGNL IAEIERIQKL MNVYRVQAQK QEEAAEKDHA LESSEAPASQ AAVPSSGLSE  840
PAPSSEDVYS SLDGQPSLKI DMNVDSRELH ATMDSETGGN MSGNVPLVVE DNGDNITKTP  900
AQDAGTSSEV AAESVNPDTV STKPESIEET LEGEGFTDHA KIDSTCVLGG DTAENQTAME  960
E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10232242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.131510.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492782.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A0D2SKW20.0A0A0D2SKW2_G
STRINGGLYMA20G36600.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64532742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5